PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676737456
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family SRS
Protein Properties Length: 225aa    MW: 25249.5 Da    PI: 8.6689
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676737456genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702124.51.3e-38114190278
     DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrel 78 
                r+g+++CqdCGnqakkdC h+RCRtCCksrgf+C+th+kstWvpaakrrer +qla++++++a+s+++++++ kr  
  676737456 114 RQGGMNCQDCGNQAKKDCPHMRCRTCCKSRGFHCQTHIKSTWVPAAKRRERLAQLASLQHHSASSRETQNANAKRLR 190
                7899********************************************************99998855554444433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051428.0E-35117192IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016235.9E-28119161IPR006510Zinc finger, lateral root primordium type 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048467Biological Processgynoecium development
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MAGFFYLGGR DNNNNKQDHH QVEKDHHHQD KSNYLYLYKD EIYNTNKGFE IWPPQYFQQQ  60
QEQQQHATAP ANFYSFGMVP SGSSSSNNNN NNRSRSLYFN VVSDHEPGGF TVTRQGGMNC  120
QDCGNQAKKD CPHMRCRTCC KSRGFHCQTH IKSTWVPAAK RRERLAQLAS LQHHSASSRE  180
TQNANAKRLR EANGGDNDDK DHSGGGGGSA LVTRVVNANS DSGII
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895860.0AC189586.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH012I05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177684.11e-131SHI-related sequence 5
SwissprotQ9LQZ51e-133SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
TrEMBLV4KCT51e-130V4KCT5_EUTSA; Uncharacterized protein (Fragment)
STRINGAT1G75520.11e-130(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26452572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.11e-118SHI-related sequence 5